mass spectrometry is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-03-03. Numbers and descriptions here follow the published literature rather than marketing material.
Regulatory agencies have not approved dihexa as a prescription drug or supplement. In many countries it falls into a gray area when sold for laboratory research. Buyers may encounter products marketed for research use only, which are not intended for human consumption. Purity and identity can vary between suppliers and batches. Certificates of analysis and independent testing are often recommended for research materials. Documentation helps verify what a vial contains.
Discussion of dihexa in online communities sometimes outpaces the scientific record. Anecdotal reports are difficult to verify and may not distinguish effects from placebo or expectation. The absence of approved human data means long-term risks remain unknown. Researchers continue to investigate related compounds and pathways. Open questions include whether animal findings translate to humans and which biological targets matter most. No consensus exists on these points. Current reviews emphasize the need for rigorous clinical research.
Most published work on dihexa consists of preclinical studies using cell cultures or rodents. Reports have described effects on synaptic connectivity and performance on cognitive tasks in some animal models. These findings are generally presented as preliminary and require independent replication. Study designs, doses, and outcome measures vary across experiments, which complicates direct comparison. No large controlled human trials have established efficacy or safety for any medical use. At present, the evidence base is limited.
Dihexa is a synthetic peptide that has been examined in laboratory and animal research. Its design is based on angiotensin IV, a naturally occurring peptide fragment produced in the body. The short name dihexa appears in scientific papers and online discussions, while the full chemical name describes a modified peptide chain. It is not a vitamin, mineral, or plant-derived compound. Suppliers typically present it as a research chemical rather than an approved medicine.
The full name often given is N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide. This name indicates a chain containing tyrosine, isoleucine, and a six-carbon amino acid derivative. Databases list a CAS Registry Number and a molecular formula for the compound. The peptide is small compared with proteins, and its structure allows it to be studied in cell cultures and animal models. Exact identity depends on the supplier's synthesis and purification process. Minor impurities can remain after synthesis.
Chemically, dihexa belongs to a broader group of angiotensin IV analogs. Researchers have modified the natural peptide to alter stability, binding, or distribution. Such changes can affect how the molecule behaves in experiments. The parent peptide angiotensin IV is involved in various physiological processes, but the modified analog is not identical to it. Public summaries sometimes blur the distinction between the natural fragment and the synthetic research compound. This distinction matters when interpreting study results.
| Property | Value | Notes |
|---|---|---|
| Development status | Preclinical research | No approved therapeutic indication has been established. |
| Human data | Limited or absent | Published controlled trials in people are not available. |
| Regulatory classification | Varies by country | Often treated as a research chemical rather than a medicine. |
| Common supply form | Lyophilized powder | Sold for laboratory use, not for human consumption. |
| Quality checks | Certificate of analysis; HPLC; mass spectrometry | Used to verify identity and purity in research settings. |
Purity and identity are usually assessed with reverse-phase high-performance liquid chromatography (RP-HPLC) and mass spectrometry. RP-HPLC separates components by hydrophobicity and can estimate peptide purity. Mass spectrometry confirms molecular mass and helps detect truncations or modifications. Some laboratories also use amino acid analysis or nuclear magnetic resonance for structural verification. A certificate of analysis from a supplier may list these results, but independent verification is often recommended for critical work.
Regulatory status varies by country, and dihexa is not widely approved as a medicine. In many jurisdictions it is treated as a research chemical, which limits its legal sale, possession, and human use. Products marketed online may lack verified purity or identity, and labels can be inaccurate. Researchers typically source material from suppliers that provide analytical documentation and follow institutional safety rules. Open questions remain about long-term stability, metabolite formation, and human pharmacokinetics.
Dihexa is typically supplied as a lyophilized powder for laboratory research. Lyophilization removes water and improves stability during transport and storage. The solid is commonly stored at -20 °C or lower, desiccated, and protected from light. Repeated freeze-thaw cycles and exposure to moisture can degrade peptides, so aliquoting and sealed containers are standard practice in most laboratory settings. These handling measures apply to research-grade material and do not imply clinical suitability.
The proposed mechanism involves interaction with the hepatocyte growth factor (HGF) system and its receptor, c-Met. Dihexa is described in some studies as an HGF mimetic, meaning it may mimic or enhance HGF-mediated signaling. Activation of c-Met can influence cell growth, survival, and cytoskeletal remodeling, pathways that intersect with synaptic plasticity. However, the precise binding targets and downstream events for dihexa are not fully established, and alternative mechanisms have been suggested.
Dihexa is a synthetic peptide with the chemical name N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide, and it is structurally related to angiotensin IV, a naturally occurring peptide fragment. Researchers developed it as a modified analog intended to alter stability and activity relative to the parent peptide. Its short sequence and fatty acid chain distinguish it from many endogenous peptides, and published studies often describe it under the abbreviation dihexa. The compound is classified as a laboratory compound rather than an approved therapeutic in most jurisdictions.
Early laboratory work focused on its effects on synaptic connectivity and neuronal signaling. In cell and animal models, dihexa has been reported to promote the formation of new synapses, a process called synaptogenesis. These findings have generated interest in cognitive research, but the evidence base remains mostly preclinical. Human clinical trials with clear safety and efficacy endpoints are limited or absent in the public literature. Whether these effects translate to humans is an open question.
Dissolution depends on the peptide’s salt form, purity, and the chosen solvent. Dimethyl sulfoxide is commonly used to prepare concentrated stock solutions, while aqueous buffers may show limited solubility. Sonication or gentle warming can sometimes aid dissolution, but excessive heat may promote degradation. Once in solution, the material is generally kept cold and protected from light. Researchers should verify solubility for each lot rather than assuming uniform behavior across suppliers.
Quality control usually combines reverse-phase high-performance liquid chromatography with mass spectrometry. Chromatography estimates purity and detects related impurities, while mass spectrometry supports molecular identity. Nuclear magnetic resonance can provide additional structural confirmation when needed. Stability data for dihexa are limited, and degradation pathways may depend on pH, temperature, and moisture. Open questions include long-term stability in different formulations and the effect of repeated freeze-thaw cycles on measured purity. Such tests help confirm that a batch matches its label before use.
Epitope tags include ALFA-tag, V5-tag, Myc-tag, HA-tag, Spot-tag, T7-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification. First described in 1984 by Munro and Pelham to detect and track proteins in COS cells, epitope tags were quickly adapted to track proteins in Xenopus oocytes; to detect and immunoaffinity purify proteins from yeast and E. coli; and to detect, pull down, and clone interaction partners of ligands in mammalian cells. At first, these tags were referred to as "peptide tag", "epitope insertion", "marker sequence", and "epitope addition", until "epitope tag" was coined and popularized. Fluorescence tags are used to give visual readout on a protein. Green fluorescent protein (GFP) and its variants are the most commonly used fluorescence tags. More advanced applications of GFP include using it as a folding reporter (fluorescent if folded, colorless if not). Protein tags may allow specific enzymatic modification (such as biotinylation by biotin ligase) or chemical modification (such as coupling to other proteins through SpyCatcher or reaction with FlAsH-EDT2 for fluorescence imaging). Often tags are combined, in order to connect proteins to multiple other components. However, with the addition of each tag comes the risk that the native function of the protein may be compromised by interactions with the tag. Therefore, after purification, tags are sometimes removed by specific proteolysis (e.g.
2010: Marcia McNutt became the first female director of the United States Geological Survey. 2011: Kazakhstani neuroscience student and computer hacker Alexandra Elbakyan launched Sci-Hub, a website that provides users with pirated copies of scholarly scientific papers. Within five years, Sci-Hub grew to contain 60 million papers and recorded over 42 million annual downloads by users. Elbakyan was finally sued by major academic publishing company Elsevier, and Sci-Hub was subsequently taken down, but it reappeared under different domain names. 2011: Taiwanese-American astrophysicist Chung-Pei Ma led a team of scientists in discovering two of the largest black holes ever observed. 2012: Israeli-American computer scientist and cryptographer Shafi Goldwasser won the Turing award for her contributions to cryptography and complexity theory. 2013: Canadian-British genetic specialist Turi King identified the 500-year-old skeletal remains of King Richard III. 2013: Kenyan ichthyologist Dorothy Wanja Nyingi published the first guide to freshwater fish species of Kenya. 2013: Canadian teenagers Miranda Wang and Jeanny Yao jointly identify a bacteria in British Columbia's Fraser River that breaks down phthalates. 2014: Norwegian psychologist and neuroscientist May-Britt Moser received the Nobel Prize in Physiology or Medicine, shared with Edvard Moser and John O'Keefe, "for their discoveries of cells that constitute a positioning system in the brain".
==== Japan ==== In Japanese cuisine, they are called harusame (春雨), literally "spring rain". Unlike Chinese glass noodles, they are usually made from potato starch. They are commonly used to make salads, or as an ingredient in hot pot dishes. They are also often used to make Japanese adaptations of Chinese and Korean dishes. Shirataki noodles are translucent, traditional Japanese noodles made from the konjac yam and sometimes tofu.
Sources: en.wikipedia.org
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Best Practices for Hit Finding == For educational purposes the European Federation for Medicinal Chemistry and Chemical Biology (EFMC) shared a series of webinars including 'Best Practices for Hit Finding' as well as 'Hit Generation Case Studies'.
== Sources == Clayton, W. Woodford; and Nelson, William. History of Bergen and Passaic Counties, New Jersey, with Biographical Sketches of Many of its Pioneers and Prominent Men., Philadelphia: Everts and Peck, 1882. Harvey, Cornelius Burnham (ed.), Genealogical History of Hudson and Bergen Counties, New Jersey. New York: New Jersey Genealogical Publishing Co., 1900. Van Valen, James M. History of Bergen County, New Jersey. New York: New Jersey Publishing and Engraving Co., 1900. Westervelt, Frances A. (Frances Augusta), 1858–1942, History of Bergen County, New Jersey, 1630–1923, Lewis Historical Publishing Company, 1923. Municipal Incorporations of the State of New Jersey (according to Counties) prepared by the Division of Local Government, Department of the Treasury (New Jersey); December 1, 1958.
In 2019, the FDA issued a drug safety warning about serious breathing difficulties in patients using pregabalin or gabapentin, particularly when combined with opioids or other CNS depressants. A 2022 meta-analysis found that combination therapy with opioids and gabapentinoids could be associated with an increased risk of CNS depression and mortality, and concluded that combination therapy with these medications requires close clinical monitoring. Combined use of pregabalin and alcohol produces additive impairment of cognitive and psychomotor function, as both substances act as central nervous system depressants. The pregabalin prescribing information advises against alcohol consumption during treatment, noting that the CNS depressant effects of the two substances compound one another. The combination of pregabalin and benzodiazepines produces additive CNS and respiratory depression, with pregabalin pharmacodynamically augmenting benzodiazepine sedation. A 2020 study published in the British Journal of Anaesthesia examining gabapentinoid prescribing trends in Scotland found that among recurrent gabapentinoid users, benzodiazepines were co-prescribed in 26.8% of cases, opioids in 49.9%, and both in a further 17.1%, and that the age-standardised death rate among those prescribed gabapentinoids was double that of the general Scottish population. The prescribing information for pregabalin advises monitoring for respiratory depression and sedation when co-prescribing with benzodiazepines.
Sources: en.wikipedia.org
Published human trials are lacking. Most evidence comes from laboratory and animal studies. Therefore, human benefits and risks are not established.
Rules differ by country and by how the product is labeled. Research chemicals are often sold for laboratory use only. Buyers should check local regulations before ordering.
Some animal studies have examined cognitive outcomes, which has led to online interest. These results do not prove cognitive enhancement in people. The term nootropic is not a regulatory category.
Dihexa is a synthetic peptide modeled on angiotensin IV. It is used in laboratory and animal research, not as an approved medicine. Human effects remain poorly characterized.